PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK41324.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family bZIP
Protein Properties Length: 135aa    MW: 15741.6 Da    PI: 9.5031
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK41324.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.82.4e-1342102363
                 XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                 + ++ rr+ +NRe+ArrsR RK+   +eL      L +eNk L +el++ ++ ++k+ +e+
  KFK41324.1  42 DERKRRRMVSNRESARRSRMRKRRHADELWSMLVHLINENKGLVDELSRAREGYEKVVQEN 102
                 456789999**********************************************999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.1E-103598No hitNo description
SMARTSM003382.1E-1440104IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.58842105IPR004827Basic-leucine zipper domain
PfamPF001703.2E-104498IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.83E-104494No hitNo description
PROSITE patternPS0003604762IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
MAGYVYNVLP YATPNSQSFN IQVPLANLPV TSDESSRNAE DDERKRRRMV SNRESARRSR  60
MRKRRHADEL WSMLVHLINE NKGLVDELSR AREGYEKVVQ ENTKLREENS ESRKMIGEIG  120
LNRFVNVDGD QMWTA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14347RKRRR
24564RRRMVSNRESARRSRMRKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177054.12e-65basic leucine-zipper 8
SwissprotQ9CA462e-67BZIP8_ARATH; Basic leucine zipper 8
TrEMBLA0A087HGS21e-95A0A087HGS2_ARAAL; Uncharacterized protein
STRINGAT1G68880.16e-65(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM150351619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68880.16e-57basic leucine-zipper 8